(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE170

ALDEN1_2.PE170       Location/Qualifiers
FT   CDS             189379..190404
FT                   /locus_tag="Alide_0172"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_0191"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_0191 hypothetical protein"
FT                   /db_xref="GI:319760908"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102195"
FT                   /translation="MKQHPHHATPAWHGSRRKALQALASAAALGAAALAPAVARAATDY
FT                   PKAPIRLVVPYPPGGPTDLVGRVVAVAMGDILKQSIFVDNKPGASGMVGSAMVAKAPAD
FT                   GYTLLSNASLHVINPAVYDKVPYDAFNDFAPITQIVDVPLVLVVRSDMPVSSVQELIAY
FT                   LKQSKGAVNFASAGNASSQHLSGELFKIRTGIAMQHVPYKGSSPALTDLMGGQVQLMFD
FT                   SMPSAMPFITSGKLKALAVTTRKRSSSLPQVPTMQEAGVAGFETSTWYGLWAPRNTPAD
FT                   VVGVLAKAAQEALRKPEVAAQYQRMGAEPVGSSPQEFEAYMKSEEKKWAEIVRLSGAKA
FT                   D"
FT                   /protein_id="YP_004124845.1"
     MKQHPHHATP AWHGSRRKAL QALASAAALG AAALAPAVAR AATDYPKAPI RLVVPYPPGG        60
     PTDLVGRVVA VAMGDILKQS IFVDNKPGAS GMVGSAMVAK APADGYTLLS NASLHVINPA       120
     VYDKVPYDAF NDFAPITQIV DVPLVLVVRS DMPVSSVQEL IAYLKQSKGA VNFASAGNAS       180
     SQHLSGELFK IRTGIAMQHV PYKGSSPALT DLMGGQVQLM FDSMPSAMPF ITSGKLKALA       240
     VTTRKRSSSL PQVPTMQEAG VAGFETSTWY GLWAPRNTPA DVVGVLAKAA QEALRKPEVA       300
     AQYQRMGAEP VGSSPQEFEA YMKSEEKKWA EIVRLSGAKA D                           341
//

If you have problems or comments...

PBIL Back to PBIL home page