(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE171

ALDEN1_2.PE171       Location/Qualifiers
FT   CDS             complement(190435..191343)
FT                   /locus_tag="Alide_0173"
FT                   /gene_family="HOG000233528" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: aav:Aave_3679 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760909"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102196"
FT                   /translation="MKILSPSLIELHAFLAVCRQGSFRRAADDLCVTQAAVSRAVQRLE
FT                   EHLAAGRLFERSPAGVVLTPRGAQWRKLVERHVLALESAAETLGRASRPRLVRLSVIPT
FT                   LSIQWLMPRLPGFHERSPGVKVELRQFRHDEDFTRDDVDLWLDVKRPSRRWPERIQTRY
FT                   LIGRELIPVCTARLAKAYRTPRDLQGATLLHHTNFPDNWARWFAKAGAPCTPRLGPGFD
FT                   LTMHLIVAAKAEMGVAVVPACLVERELRAGELVMPFDVEVSSGRGYFLCWKRDAAAFAA
FT                   REEFSGWLLEQAHAGGGPGAG"
FT                   /protein_id="YP_004124846.1"
     MKILSPSLIE LHAFLAVCRQ GSFRRAADDL CVTQAAVSRA VQRLEEHLAA GRLFERSPAG        60
     VVLTPRGAQW RKLVERHVLA LESAAETLGR ASRPRLVRLS VIPTLSIQWL MPRLPGFHER       120
     SPGVKVELRQ FRHDEDFTRD DVDLWLDVKR PSRRWPERIQ TRYLIGRELI PVCTARLAKA       180
     YRTPRDLQGA TLLHHTNFPD NWARWFAKAG APCTPRLGPG FDLTMHLIVA AKAEMGVAVV       240
     PACLVERELR AGELVMPFDV EVSSGRGYFL CWKRDAAAFA AREEFSGWLL EQAHAGGGPG       300
     AG                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page