(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE172

ALDEN1_2.PE172       Location/Qualifiers
FT   CDS             191452..192435
FT                   /locus_tag="Alide_0174"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_3678"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_3678 hypothetical protein"
FT                   /db_xref="GI:319760910"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102197"
FT                   /translation="MPINRREFVGLAAAGSLAPWVHAHAADAYPSKPITLVVPFTPGGS
FT                   VDNSGRLMADRLSRELGVPVIVDNKGGAGGALGSAFVAKAKPDGYTLVVASQSTHVVNP
FT                   AVNPNLPYDAVKDFAPITLIDRLANVLLVNASVPVQTFADLVKYAQANPGKLNYASAGV
FT                   GSVSHLSMELLKTQARIHVTHIPYRGAGVALTDLLAGQVQLAWNNLSSNLPNIRNGKLR
FT                   ALAVAAPQRVPQLPSVPTFAELKLPDLNLTSWTGLAAPAHTPDVIIGRLYSAVRKVLQD
FT                   PATQATWVERGMMVPEDVKPQAYQAEIVERIKFYQRIAKANNIVIE"
FT                   /protein_id="YP_004124847.1"
     MPINRREFVG LAAAGSLAPW VHAHAADAYP SKPITLVVPF TPGGSVDNSG RLMADRLSRE        60
     LGVPVIVDNK GGAGGALGSA FVAKAKPDGY TLVVASQSTH VVNPAVNPNL PYDAVKDFAP       120
     ITLIDRLANV LLVNASVPVQ TFADLVKYAQ ANPGKLNYAS AGVGSVSHLS MELLKTQARI       180
     HVTHIPYRGA GVALTDLLAG QVQLAWNNLS SNLPNIRNGK LRALAVAAPQ RVPQLPSVPT       240
     FAELKLPDLN LTSWTGLAAP AHTPDVIIGR LYSAVRKVLQ DPATQATWVE RGMMVPEDVK       300
     PQAYQAEIVE RIKFYQRIAK ANNIVIE                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page