(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE173

ALDEN1_2.PE173       Location/Qualifiers
FT   CDS             192432..193631
FT                   /locus_tag="Alide_0175"
FT                   /gene_family="HOG000241403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.32"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: aav:Aave_3677
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="GI:319760911"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="GeneID:10102198"
FT                   /translation="MSAAPDRRAAYARIDQLLPYEQELVAIRRHLHQNPELAFAEHGTA
FT                   DFVAGRLQEWGYEVARGIGGTGVVGTLRQGDGSRRLGIRADMDALPIQEATGAAHASRA
FT                   PGLMHACGHDGHMAMLLGAAKYLARQRNFSGTLHLIFQPAEERGFDSGGKAMVDDGLFE
FT                   RFPCDAVYAMHNHPGVPQGRFLLRSGAFMAAGDRVFIKVLGVGGHAARPHLAADPLVAA
FT                   AAIVTGLQTVVARNVDPAESAVVTVGRLRAGDALNVIPADAEIGISVRSFAPQVRALLK
FT                   ERITALATGIAQAHGTRAEIDYVEGYPVLVNDPEAVALAAQVATDLVGADAVDLEHPRL
FT                   MGSEDFAYMLQRCPGALVRIGNGPADGGRGLHNPKYDFNDCNLPYGAAFWSQLAQRFLC
FT                   "
FT                   /product="amidohydrolase"
FT                   /protein_id="YP_004124848.1"
     MSAAPDRRAA YARIDQLLPY EQELVAIRRH LHQNPELAFA EHGTADFVAG RLQEWGYEVA        60
     RGIGGTGVVG TLRQGDGSRR LGIRADMDAL PIQEATGAAH ASRAPGLMHA CGHDGHMAML       120
     LGAAKYLARQ RNFSGTLHLI FQPAEERGFD SGGKAMVDDG LFERFPCDAV YAMHNHPGVP       180
     QGRFLLRSGA FMAAGDRVFI KVLGVGGHAA RPHLAADPLV AAAAIVTGLQ TVVARNVDPA       240
     ESAVVTVGRL RAGDALNVIP ADAEIGISVR SFAPQVRALL KERITALATG IAQAHGTRAE       300
     IDYVEGYPVL VNDPEAVALA AQVATDLVGA DAVDLEHPRL MGSEDFAYML QRCPGALVRI       360
     GNGPADGGRG LHNPKYDFND CNLPYGAAFW SQLAQRFLC                              399
//

If you have problems or comments...

PBIL Back to PBIL home page