(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE176

ALDEN1_2.PE176       Location/Qualifiers
FT   CDS             196319..197302
FT                   /locus_tag="Alide_0178"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0145"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0145 hypothetical protein"
FT                   /db_xref="GI:319760914"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:10102201"
FT                   /translation="MPIHMTRRSLVAGGLLAAAAQPFAALASDAWPTKPVRFIVPFPPG
FT                   GPVDTTARAASVKLSEIWKTPTVIDNRAGAGGVVGAQAAAREAPDGYTLFMGAIHHSVN
FT                   PTLMGNLPYDIERDFAPISFAAMFPVFIVAHQSVPANTLKELIALARKPGSNLSYGSSG
FT                   NGGGTHLAGELFNMEAGTKLQHVPYKGSAPAMNDLLGGQVQLMFSDAPTALPHIKSGRI
FT                   KVLAVASRQRSAMLPDVPTAAEAGLPGYEAYSWAALFAPAKTPQAVLDKINADFNTAFR
FT                   DPAVRQRLLDAGAEAAPGTQQEMRQFLRSELAKWAKVIKTAGITAG"
FT                   /protein_id="YP_004124851.1"
     MPIHMTRRSL VAGGLLAAAA QPFAALASDA WPTKPVRFIV PFPPGGPVDT TARAASVKLS        60
     EIWKTPTVID NRAGAGGVVG AQAAAREAPD GYTLFMGAIH HSVNPTLMGN LPYDIERDFA       120
     PISFAAMFPV FIVAHQSVPA NTLKELIALA RKPGSNLSYG SSGNGGGTHL AGELFNMEAG       180
     TKLQHVPYKG SAPAMNDLLG GQVQLMFSDA PTALPHIKSG RIKVLAVASR QRSAMLPDVP       240
     TAAEAGLPGY EAYSWAALFA PAKTPQAVLD KINADFNTAF RDPAVRQRLL DAGAEAAPGT       300
     QQEMRQFLRS ELAKWAKVIK TAGITAG                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page