(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE178

ALDEN1_2.PE178       Location/Qualifiers
FT   CDS             complement(198379..199560)
FT                   /locus_tag="Alide_0180"
FT                   /gene_family="HOG000241403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /codon_start="1"
FT                   /EC_number="3.5.1.32"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; manually curated; KEGG: reu:Reut_B4300 peptidase
FT                   M20D, amidohydrolase; TIGRFAM: amidohydrolase"
FT                   /db_xref="GI:319760916"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010168"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="GeneID:10102203"
FT                   /translation="MDPSVSTALLHAMRALSPEFIAIRRDLHAHPELAFEERRTSDLVA
FT                   ERLAAWGYQVHRGLGGTGVVGTLRKGGGSRSLGIRADMDALPIQEKTGLDYASRHVGKM
FT                   HACGHDGHTAILLCAARYLAESADFSGTLHLIFQPAEENEGGALRMVDEGLFTLFPCDE
FT                   VYALHNSPGLPVGQMAISPGPLMASFDRATVTLRGRGAHGAMPHHGIDPMQCAASITLG
FT                   LQSIVSREIDALKSAVITVGSIQAGEAYNVVPESAQLKIGVRTLDPRVRTLVEQRIREF
FT                   IAAQAQSYQLQAEVVYERKYPVLVNHAVQTEVLRQAAMRLVGADSVVERPPVMGSEDFA
FT                   YMLEHRPGAYIRLGNGTGEDGGCNVHNPLYDFNDNALPIGAALWVHLAQSSLV"
FT                   /product="amidohydrolase"
FT                   /protein_id="YP_004124853.1"
     MDPSVSTALL HAMRALSPEF IAIRRDLHAH PELAFEERRT SDLVAERLAA WGYQVHRGLG        60
     GTGVVGTLRK GGGSRSLGIR ADMDALPIQE KTGLDYASRH VGKMHACGHD GHTAILLCAA       120
     RYLAESADFS GTLHLIFQPA EENEGGALRM VDEGLFTLFP CDEVYALHNS PGLPVGQMAI       180
     SPGPLMASFD RATVTLRGRG AHGAMPHHGI DPMQCAASIT LGLQSIVSRE IDALKSAVIT       240
     VGSIQAGEAY NVVPESAQLK IGVRTLDPRV RTLVEQRIRE FIAAQAQSYQ LQAEVVYERK       300
     YPVLVNHAVQ TEVLRQAAMR LVGADSVVER PPVMGSEDFA YMLEHRPGAY IRLGNGTGED       360
     GGCNVHNPLY DFNDNALPIG AALWVHLAQS SLV                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page