(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE18

ALDEN1_2.PE18        Location/Qualifiers
FT   CDS             22262..22741
FT                   /locus_tag="Alide_0018"
FT                   /gene_family="HOG000229978" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /codon_start="1"
FT                   /product="nlp/p60 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NLP/P60 protein; KEGG: ajs:Ajs_0001 NLP/P60
FT                   protein"
FT                   /db_xref="GI:319760756"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="GeneID:10102041"
FT                   /translation="MRSLALPALMLAAGLLAAGCGTAPHGAPRASAYPRLSSEQSSDIA
FT                   IHALGLVGTPYRYGGNTPDGGFDCSGLIGYVYGSRAGVAPPRTVALLSGFGEPVDEDEL
FT                   RTGDLVVFGGSRPTHAGIYVGGGRFVHAPSTGGTVRLDHLQSRYWAQQHASFRRP"
FT                   /protein_id="YP_004124693.1"
     MRSLALPALM LAAGLLAAGC GTAPHGAPRA SAYPRLSSEQ SSDIAIHALG LVGTPYRYGG        60
     NTPDGGFDCS GLIGYVYGSR AGVAPPRTVA LLSGFGEPVD EDELRTGDLV VFGGSRPTHA       120
     GIYVGGGRFV HAPSTGGTVR LDHLQSRYWA QQHASFRRP                              159
//

If you have problems or comments...

PBIL Back to PBIL home page