(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE180

ALDEN1_2.PE180       Location/Qualifiers
FT   CDS             200241..201449
FT                   /locus_tag="Alide_0182"
FT                   /gene_family="HOG000221740" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0129"
FT                   /codon_start="1"
FT                   /product="thiolase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0129 thiolase"
FT                   /db_xref="GI:319760918"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:10102205"
FT                   /translation="MSRIPRSHLDAAAVNRPLRGRVAIAGAATYGCGEAPGMDDMTLLV
FT                   RAAQAAVADAGLSMQDIDGLATCSVNASMWPMPVIEHLGINPTYVDGTMIGGSSFIAHL
FT                   LPAIRALEAGQCKAVLVCYGSAQRSATFGRKESQAARRFLDPQPYEFPYEPVLPVTAYA
FT                   LAAARHMHEFGTTRTQLAEVAVAARAWAQQNPEAFMRDPLTIEDVLAARPIASPLTVRD
FT                   CCLVTDGGGAIVLTRAERARDLPRPPVYVLGNATAIWNRQISCMPDLTTTSASQSGAQA
FT                   FAMAGLKAADMDMAQVYDAFTINTILFLEDLGFCAKGEGGAFVENGGIAPGGRLAVNTN
FT                   GGGLSCVHPGMYGIFALIEAVRQLRGEAGARQLKRHSTAVVHGNGGTLSSQSTAVLGTT
FT                   ETL"
FT                   /protein_id="YP_004124855.1"
     MSRIPRSHLD AAAVNRPLRG RVAIAGAATY GCGEAPGMDD MTLLVRAAQA AVADAGLSMQ        60
     DIDGLATCSV NASMWPMPVI EHLGINPTYV DGTMIGGSSF IAHLLPAIRA LEAGQCKAVL       120
     VCYGSAQRSA TFGRKESQAA RRFLDPQPYE FPYEPVLPVT AYALAAARHM HEFGTTRTQL       180
     AEVAVAARAW AQQNPEAFMR DPLTIEDVLA ARPIASPLTV RDCCLVTDGG GAIVLTRAER       240
     ARDLPRPPVY VLGNATAIWN RQISCMPDLT TTSASQSGAQ AFAMAGLKAA DMDMAQVYDA       300
     FTINTILFLE DLGFCAKGEG GAFVENGGIA PGGRLAVNTN GGGLSCVHPG MYGIFALIEA       360
     VRQLRGEAGA RQLKRHSTAV VHGNGGTLSS QSTAVLGTTE TL                          402
//

If you have problems or comments...

PBIL Back to PBIL home page