(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE181

ALDEN1_2.PE181       Location/Qualifiers
FT   CDS             201469..202626
FT                   /locus_tag="Alide_0183"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: dia:Dtpsy_0148 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="GI:319760919"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102206"
FT                   /translation="MIRDPEILEALLDSVRRFVRERLVPAENEVAETDEIPETIVQEMR
FT                   ELGLFGMTIPEKFGGLELTMEEECRVLLELCQTAPAFRSVIGTTVGIGSQGILMDGTPE
FT                   QQAQWLPKLATGEVIASFALTEPEAGSDAASLRTTAILQGDHYVVNGTKRFITNAPHAG
FT                   MFTLMARTNPQDKGAGGVSSFIVDAKSPGISFGKYDKKMGQRGAHTCDVIFDNVKVPAA
FT                   NLIGLKEGQGFKTAMKVLEKGRIHIAAVAVGVAKRILRDALAYALERKQFGQPICEFQL
FT                   VQAMLADSQAELYAAECMTIDAARRRDDGHNVSTEASCAKMFATEMCGRVADRAVQILG
FT                   GAGYMAEYGIERFYRDVRLFRLYEGTTQIQQIIIARNMVRAARAA"
FT                   /protein_id="YP_004124856.1"
     MIRDPEILEA LLDSVRRFVR ERLVPAENEV AETDEIPETI VQEMRELGLF GMTIPEKFGG        60
     LELTMEEECR VLLELCQTAP AFRSVIGTTV GIGSQGILMD GTPEQQAQWL PKLATGEVIA       120
     SFALTEPEAG SDAASLRTTA ILQGDHYVVN GTKRFITNAP HAGMFTLMAR TNPQDKGAGG       180
     VSSFIVDAKS PGISFGKYDK KMGQRGAHTC DVIFDNVKVP AANLIGLKEG QGFKTAMKVL       240
     EKGRIHIAAV AVGVAKRILR DALAYALERK QFGQPICEFQ LVQAMLADSQ AELYAAECMT       300
     IDAARRRDDG HNVSTEASCA KMFATEMCGR VADRAVQILG GAGYMAEYGI ERFYRDVRLF       360
     RLYEGTTQIQ QIIIARNMVR AARAA                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page