(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE182

ALDEN1_2.PE182       Location/Qualifiers
FT   CDS             202623..203054
FT                   /locus_tag="Alide_0184"
FT                   /gene_family="HOG000066992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /codon_start="1"
FT                   /product="thioesterase superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dac:Daci_0175 thioesterase superfamily protein"
FT                   /db_xref="GI:319760920"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="GeneID:10102207"
FT                   /translation="MSEAGLPPDRNAFMRLIGAAQVPAPPGKVHMRLPHMREELLNQLP
FT                   AAHGGVVMTLLDSVMARAAAELPTAPSRTAVTVEMSSRFHRPARGALLAEGWVVHASRS
FT                   LCSCAAQLLDADGRLVATASGTFKYWLGKTSAGHPPSGG"
FT                   /protein_id="YP_004124857.1"
     MSEAGLPPDR NAFMRLIGAA QVPAPPGKVH MRLPHMREEL LNQLPAAHGG VVMTLLDSVM        60
     ARAAAELPTA PSRTAVTVEM SSRFHRPARG ALLAEGWVVH ASRSLCSCAA QLLDADGRLV       120
     ATASGTFKYW LGKTSAGHPP SGG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page