(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE183

ALDEN1_2.PE183       Location/Qualifiers
FT   CDS             complement(203051..203800)
FT                   /locus_tag="Alide_0185"
FT                   /gene_family="HOG000142058" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: vei:Veis_2216 regulatory proteins, IclR; PFAM:
FT                   regulatory protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760921"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102208"
FT                   /translation="MPPSHPVNGAQSVERACALLRRIAAGHAEGVPLRRLVDDTGLDRT
FT                   TAWRLVSSLAAQGLVHKDEATGLYHLGLEAAALGAACMDRSPLVRACLPAMKALARLSG
FT                   DNVFLVVRSGDHSHCLHLEEGEHRVRSFALNVGGTRLLGQGVGSIALLARLGDDALVAH
FT                   YRRHEAEYQADDVGLARLRRWAVQTRDCGHSYGSSGGVAGIGLGFRVGSCADAALSVIA
FT                   PRSRLPRSRGAELALAMRREMGAWRLL"
FT                   /protein_id="YP_004124858.1"
     MPPSHPVNGA QSVERACALL RRIAAGHAEG VPLRRLVDDT GLDRTTAWRL VSSLAAQGLV        60
     HKDEATGLYH LGLEAAALGA ACMDRSPLVR ACLPAMKALA RLSGDNVFLV VRSGDHSHCL       120
     HLEEGEHRVR SFALNVGGTR LLGQGVGSIA LLARLGDDAL VAHYRRHEAE YQADDVGLAR       180
     LRRWAVQTRD CGHSYGSSGG VAGIGLGFRV GSCADAALSV IAPRSRLPRS RGAELALAMR       240
     REMGAWRLL                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page