(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE184

ALDEN1_2.PE184       Location/Qualifiers
FT   CDS             203931..204917
FT                   /locus_tag="Alide_0186"
FT                   /gene_family="HOG000126605" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10518"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Twin-arginine translocation pathway, signal
FT                   sequence, subgroup; KEGG: vei:Veis_2212 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760922"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="GeneID:10102209"
FT                   /translation="MTANIDRRHLVQGLAAATALTALGARAQATPFPSRPVTLVVPFPA
FT                   GGATDSLVRQIAELAGRELGQPVVVENKPGAAGVLGANHVVRAAPDGYTLSVLPEPVFR
FT                   LPHLQKTAFDPMNDFSYVIHLSGYALGIAVRNDAPWRDWAGVVAEAKKRPGQISYGTTG
FT                   INGTMHVTVEEMAQRAGVRLNHVPYKGESEIIAALMGGHIDLGVTAGGIAPMVDDGRAR
FT                   VLVLWTARRAPRWPGVPTLREIGIDMVANSPFGIAGPKGLPPAVVKTLHDAFRKALEAP
FT                   ATRATLERLNQESAYLDSEAYAAFARERYETSRQQVQRLGLKPNAQQ"
FT                   /protein_id="YP_004124859.1"
     MTANIDRRHL VQGLAAATAL TALGARAQAT PFPSRPVTLV VPFPAGGATD SLVRQIAELA        60
     GRELGQPVVV ENKPGAAGVL GANHVVRAAP DGYTLSVLPE PVFRLPHLQK TAFDPMNDFS       120
     YVIHLSGYAL GIAVRNDAPW RDWAGVVAEA KKRPGQISYG TTGINGTMHV TVEEMAQRAG       180
     VRLNHVPYKG ESEIIAALMG GHIDLGVTAG GIAPMVDDGR ARVLVLWTAR RAPRWPGVPT       240
     LREIGIDMVA NSPFGIAGPK GLPPAVVKTL HDAFRKALEA PATRATLERL NQESAYLDSE       300
     AYAAFARERY ETSRQQVQRL GLKPNAQQ                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page