(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE186

ALDEN1_2.PE186       Location/Qualifiers
FT   CDS             205774..206922
FT                   /locus_tag="Alide_0188"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reu:Reut_B5206 acyl-CoA dehydrogenase,
FT                   C-terminal:acyl-CoA dehydrogenase, central region:acyl-CoA
FT                   dehydrogenase, N-terminal"
FT                   /db_xref="GI:319760924"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102211"
FT                   /translation="MLQAPNPRHYTAEHETLRATVRRFFEKEVAPHVSAWDEAGGFPRD
FT                   LYRKAAEAGLLQLGFPEAYGGVECDAFHRMILFEERAWGGSGGVASGLFSHTIGAPPIA
FT                   VAGSEALKARVLPGILAGEQISALAITEPGGGSDVAQLATTARRDGGHYVVNGSKLFIT
FT                   SGMRADWFTVAVRTGGPGAAGVSLLLVPGDTPGLTRSPLQKMGWWASDTAEIGFTDCRV
FT                   PVENLLGDEGQGFAILMRNFNHERLALAAAACGYAQVCLHDAVAWARERRTFGQPLSER
FT                   QVIRHRLVDMATRIEATRALLDDLASRLDAGESPAAQIAMAKNFATRTFQFCADAAVQI
FT                   LGGMGFMRGTRVERLYREVKVMMIGGGAEEVMKDLIAKRLGL"
FT                   /protein_id="YP_004124861.1"
     MLQAPNPRHY TAEHETLRAT VRRFFEKEVA PHVSAWDEAG GFPRDLYRKA AEAGLLQLGF        60
     PEAYGGVECD AFHRMILFEE RAWGGSGGVA SGLFSHTIGA PPIAVAGSEA LKARVLPGIL       120
     AGEQISALAI TEPGGGSDVA QLATTARRDG GHYVVNGSKL FITSGMRADW FTVAVRTGGP       180
     GAAGVSLLLV PGDTPGLTRS PLQKMGWWAS DTAEIGFTDC RVPVENLLGD EGQGFAILMR       240
     NFNHERLALA AAACGYAQVC LHDAVAWARE RRTFGQPLSE RQVIRHRLVD MATRIEATRA       300
     LLDDLASRLD AGESPAAQIA MAKNFATRTF QFCADAAVQI LGGMGFMRGT RVERLYREVK       360
     VMMIGGGAEE VMKDLIAKRL GL                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page