(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE188

ALDEN1_2.PE188       Location/Qualifiers
FT   CDS             208602..209765
FT                   /locus_tag="Alide_0190"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: reu:Reut_B4462 acyl-CoA dehydrogenase,
FT                   C-terminal:acyl-CoA dehydrogenase, central region:acyl-CoA
FT                   dehydrogenase, N-terminal"
FT                   /db_xref="GI:319760926"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102213"
FT                   /translation="MLYTPEHHELMASIRRFIAAEIDPFVDEWEANEIFPAPELFKKMG
FT                   RLGFLGITKPEAYGGMGLDFSYALAAAEAIGHARAQGVGMGIGVQSNMATPALAAFGSD
FT                   ELKREFLAPAIAGDVVVSIGVSEQGAGSDVSSLKTRARRDGDDYVISGSKMWITNGTQA
FT                   DWICLLCNTSDGPVHKNKSLIVVPLKENGKRAKGVEVQKIKKFGMWSSDTAQIFFDEVR
FT                   VPVRHRIGEEGMGFIYQMKQFQEERLDGAARRLASIDLINETADYLRQRIAFGRPLLDN
FT                   QFIQYKLAELKTELEALRSLTYRATLAYVNGEDVIELASMAKLKAGRLGREIADWCMQF
FT                   QGGMGYTWDNRVSRAYRDYRLGSIGGGADEVMMMVIARKMGLMDMGA"
FT                   /protein_id="YP_004124863.1"
     MLYTPEHHEL MASIRRFIAA EIDPFVDEWE ANEIFPAPEL FKKMGRLGFL GITKPEAYGG        60
     MGLDFSYALA AAEAIGHARA QGVGMGIGVQ SNMATPALAA FGSDELKREF LAPAIAGDVV       120
     VSIGVSEQGA GSDVSSLKTR ARRDGDDYVI SGSKMWITNG TQADWICLLC NTSDGPVHKN       180
     KSLIVVPLKE NGKRAKGVEV QKIKKFGMWS SDTAQIFFDE VRVPVRHRIG EEGMGFIYQM       240
     KQFQEERLDG AARRLASIDL INETADYLRQ RIAFGRPLLD NQFIQYKLAE LKTELEALRS       300
     LTYRATLAYV NGEDVIELAS MAKLKAGRLG REIADWCMQF QGGMGYTWDN RVSRAYRDYR       360
     LGSIGGGADE VMMMVIARKM GLMDMGA                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page