(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE19

ALDEN1_2.PE19        Location/Qualifiers
FT   CDS             22780..23883
FT                   /locus_tag="Alide_0019"
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00034"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.54"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; KEGG: ajs:Ajs_0002
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="GI:319760757"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="GeneID:10102042"
FT                   /translation="MTLTDRPHPTPSTHDTTRIDDLRIKAVRPLITPAILEEWLPASDA
FT                   AQALVEESRLQISRVLHGQDDRLIVVVGPCSIHDHDQAMEYARQLLAQARALAQDLLIV
FT                   MRVYFEKPRTTVGWKGYINDPHLDGSFAINEGLERARALLLDILALGLPVGTEFLDLLS
FT                   PQFISDLVSWGAIGARTTESQSHRQLASGLSCPVGFKNGTDGGVKVAADAIQAAQAPHA
FT                   FMGMTKMGQAAIFETRGNRDCHVILRGGKAPNYGAADVQAACDLLEKAGQRAQVMIDLS
FT                   HANSSKQHARQITVAAEVARQIAAGDARITGVMIESHLEEGRQDIVPGQALRHGVSVTD
FT                   ACISFAQTVPVLEQLAAAVRARRAAAS"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /protein_id="YP_004124694.1"
     MTLTDRPHPT PSTHDTTRID DLRIKAVRPL ITPAILEEWL PASDAAQALV EESRLQISRV        60
     LHGQDDRLIV VVGPCSIHDH DQAMEYARQL LAQARALAQD LLIVMRVYFE KPRTTVGWKG       120
     YINDPHLDGS FAINEGLERA RALLLDILAL GLPVGTEFLD LLSPQFISDL VSWGAIGART       180
     TESQSHRQLA SGLSCPVGFK NGTDGGVKVA ADAIQAAQAP HAFMGMTKMG QAAIFETRGN       240
     RDCHVILRGG KAPNYGAADV QAACDLLEKA GQRAQVMIDL SHANSSKQHA RQITVAAEVA       300
     RQIAAGDARI TGVMIESHLE EGRQDIVPGQ ALRHGVSVTD ACISFAQTVP VLEQLAAAVR       360
     ARRAAAS                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page