(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE191

ALDEN1_2.PE191       Location/Qualifiers
FT   CDS             212593..214407
FT                   /locus_tag="Alide_0193"
FT                   /gene_family="HOG000258966" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   reu:Reut_B4459 hypothetical protein"
FT                   /db_xref="GI:319760929"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="GeneID:10102216"
FT                   /translation="MKTKTVRIGGASGFWGDSAIATPQLLQVPGLQYLVYDYLAETTMS
FT                   ILARARAKDAALGYATDFVHAAMAPNLRAICERGVRVVANAGGLNPEACRDALAAVAAA
FT                   QGLAPRIAVVTGDDLMPQFEQLRAAGLRDLHTGEAPPAALYSANAYVGARGIAQALALG
FT                   ADIVITGRCVDSAVVVGVLAHEFGWGWDDWDRIAAGTLAGHVIECGAQATGGLFTDWQQ
FT                   VPGWADMGYPVIDCAADGSFVLSKPEGTGGLIHPGAVAEQVLYEVGDPAHYLMPDVTCD
FT                   FRQVHVEALDAGHVRVAGARGRPPTGSYKANGTWRDGYQLQLMMAIRGIDAPAKARKTA
FT                   DALLARTRALMREQGFADYTETCVELLGCEALYGPNARALPTREVVLRIGARHADPKAL
FT                   AFLQRECASAGTSMGPGTRSSFAGRADVQPVIKVFSFLVPKDQVALQVVLGERVEPVAL
FT                   PAAAPAVAAAPLPAPPAAAPVVHDGIDVPLVALAWARSGDKGDDENIGVIARRPEFLPL
FT                   LRAQLTPERVKAWFAHLVQGEVERFEVPGLQALNFVLHQALAGGGVASLRSDPLGKSFA
FT                   QMLLDWPVRVPRRWADDGLLAPHHLLAD"
FT                   /protein_id="YP_004124866.1"
     MKTKTVRIGG ASGFWGDSAI ATPQLLQVPG LQYLVYDYLA ETTMSILARA RAKDAALGYA        60
     TDFVHAAMAP NLRAICERGV RVVANAGGLN PEACRDALAA VAAAQGLAPR IAVVTGDDLM       120
     PQFEQLRAAG LRDLHTGEAP PAALYSANAY VGARGIAQAL ALGADIVITG RCVDSAVVVG       180
     VLAHEFGWGW DDWDRIAAGT LAGHVIECGA QATGGLFTDW QQVPGWADMG YPVIDCAADG       240
     SFVLSKPEGT GGLIHPGAVA EQVLYEVGDP AHYLMPDVTC DFRQVHVEAL DAGHVRVAGA       300
     RGRPPTGSYK ANGTWRDGYQ LQLMMAIRGI DAPAKARKTA DALLARTRAL MREQGFADYT       360
     ETCVELLGCE ALYGPNARAL PTREVVLRIG ARHADPKALA FLQRECASAG TSMGPGTRSS       420
     FAGRADVQPV IKVFSFLVPK DQVALQVVLG ERVEPVALPA AAPAVAAAPL PAPPAAAPVV       480
     HDGIDVPLVA LAWARSGDKG DDENIGVIAR RPEFLPLLRA QLTPERVKAW FAHLVQGEVE       540
     RFEVPGLQAL NFVLHQALAG GGVASLRSDP LGKSFAQMLL DWPVRVPRRW ADDGLLAPHH       600
     LLAD                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page