(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE194

ALDEN1_2.PE194       Location/Qualifiers
FT   CDS             complement(216685..217602)
FT                   /locus_tag="Alide_0196"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dia:Dtpsy_0150 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:319760932"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102219"
FT                   /translation="MAMHFDLVDLRLMVHIADANSMTRGAELSFISLPAASTRIKNLEE
FT                   SIGTKLLYRTSQGVTLTPPGQAFVTHARMVLGQIEHLRGDMQEYVRGIKGHVRVFANTT
FT                   SLGEFLPPVLRHFLRRNPDVNIDLRERLSHDIVRAVTEGQTDIGIVAGLVRTENLETLP
FT                   YRRDRLVLVVPRGHPLDGQMQIDFSDTLELDYVGLHESSAIHAFLRQASDQLHRPIKQR
FT                   IQVGNFETACRMIEAGVGVGVLPESAASRHAHAMDIAIVPLSDAWSVREMQICVRSLEA
FT                   LPSFAQELVELLVADAQGRLQLDR"
FT                   /protein_id="YP_004124869.1"
     MAMHFDLVDL RLMVHIADAN SMTRGAELSF ISLPAASTRI KNLEESIGTK LLYRTSQGVT        60
     LTPPGQAFVT HARMVLGQIE HLRGDMQEYV RGIKGHVRVF ANTTSLGEFL PPVLRHFLRR       120
     NPDVNIDLRE RLSHDIVRAV TEGQTDIGIV AGLVRTENLE TLPYRRDRLV LVVPRGHPLD       180
     GQMQIDFSDT LELDYVGLHE SSAIHAFLRQ ASDQLHRPIK QRIQVGNFET ACRMIEAGVG       240
     VGVLPESAAS RHAHAMDIAI VPLSDAWSVR EMQICVRSLE ALPSFAQELV ELLVADAQGR       300
     LQLDR                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page