(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE195

ALDEN1_2.PE195       Location/Qualifiers
FT   CDS             217712..218989
FT                   /locus_tag="Alide_0197"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: dia:Dtpsy_0151 L-carnitine
FT                   dehydratase/bile acid-inducible protein F"
FT                   /db_xref="GI:319760933"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102220"
FT                   /translation="MTAADTSSSAATGALSHLRVLDLSRVLAGPWCTQNLADMGADVIK
FT                   IEKPGDGDDTRHWGPPFFPDAEGKPTSHACYFAACNRNKRSVTVDMATPEGQQLIRELA
FT                   MQSDVVVENFKTGGLKRYGLDYASLSALNPRLIYCSVTGFGHTGPYAPRAGYDLLIQAM
FT                   SGLMSITGHADGEPGGGPMRVGVAVIDLFTGMYATTAILGALEARHRTGRGQHIDMALL
FT                   DVAMAILANQGAGFLNAGNVPKRQGNTHPSVVPYQDFPTQDGNMLLAIGNDGQFARFCE
FT                   VAGVDWASDERFTQNAGRVIHRDTLIPMMAALTRTRSTAEWVRLLEDKAVPCGPINHIG
FT                   QAFDDEQVRARSLRIVQERYPGAQPPAGETVNRVVTTASPLRLSDTPVTLRHAPPALGQ
FT                   HTDEVLRERLGLDAARLQELRAKGVL"
FT                   /protein_id="YP_004124870.1"
     MTAADTSSSA ATGALSHLRV LDLSRVLAGP WCTQNLADMG ADVIKIEKPG DGDDTRHWGP        60
     PFFPDAEGKP TSHACYFAAC NRNKRSVTVD MATPEGQQLI RELAMQSDVV VENFKTGGLK       120
     RYGLDYASLS ALNPRLIYCS VTGFGHTGPY APRAGYDLLI QAMSGLMSIT GHADGEPGGG       180
     PMRVGVAVID LFTGMYATTA ILGALEARHR TGRGQHIDMA LLDVAMAILA NQGAGFLNAG       240
     NVPKRQGNTH PSVVPYQDFP TQDGNMLLAI GNDGQFARFC EVAGVDWASD ERFTQNAGRV       300
     IHRDTLIPMM AALTRTRSTA EWVRLLEDKA VPCGPINHIG QAFDDEQVRA RSLRIVQERY       360
     PGAQPPAGET VNRVVTTASP LRLSDTPVTL RHAPPALGQH TDEVLRERLG LDAARLQELR       420
     AKGVL                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page