(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE196

ALDEN1_2.PE196       Location/Qualifiers
FT   CDS             complement(219041..219940)
FT                   /locus_tag="Alide_0198"
FT                   /gene_family="HOG000233524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ctt:CtCNB1_0218 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:319760934"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102221"
FT                   /translation="MQFELKDLRLFLLVAQRGSLSRAAEQLHLSLAATSARVKALEERV
FT                   GMPLLIREARGVRLSPPGEAFLFHARAILQQARQLQAELQEYGAGLRGHLRVFANTTAV
FT                   TDFMPDILAAYLTAHPHISVDLEERPNARIAEDIREGRADLGIVAGEVDTHGLQSLHFS
FT                   TDRLVLVTPPTPAWRAIQEIPFAQVLHENFVGMHRTSTLQTFLDGMGQQLGHTLKLRIQ
FT                   LASFDAMCRMVAAGVGIAVVPESGAMRYAQGAHVHQVQLMDSWAVRPRYMLVRTLQGLP
FT                   AHAQALMAAVQAHHAARA"
FT                   /protein_id="YP_004124871.1"
     MQFELKDLRL FLLVAQRGSL SRAAEQLHLS LAATSARVKA LEERVGMPLL IREARGVRLS        60
     PPGEAFLFHA RAILQQARQL QAELQEYGAG LRGHLRVFAN TTAVTDFMPD ILAAYLTAHP       120
     HISVDLEERP NARIAEDIRE GRADLGIVAG EVDTHGLQSL HFSTDRLVLV TPPTPAWRAI       180
     QEIPFAQVLH ENFVGMHRTS TLQTFLDGMG QQLGHTLKLR IQLASFDAMC RMVAAGVGIA       240
     VVPESGAMRY AQGAHVHQVQ LMDSWAVRPR YMLVRTLQGL PAHAQALMAA VQAHHAARA        299
//

If you have problems or comments...

PBIL Back to PBIL home page