(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE197

ALDEN1_2.PE197       Location/Qualifiers
FT   CDS             220078..221091
FT                   /locus_tag="Alide_0199"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_0219"
FT                   /codon_start="1"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_0219 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="GI:319760935"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102222"
FT                   /translation="MRRADFAIITRRALCAGAVLGWALTAAPGACAQGAYPSRPIVMVV
FT                   PQAAGGTNDIVGRVVAQKLAEKLGGSAVVENKPGAGGNIGTQAVARAPKDGYTLLMTIS
FT                   SSQAINPALYKAPGFDPVADFQPISLIGAVPNVLLAHPSFPAKTVPELLALAKSQPRTL
FT                   QYASAGNGTLNHLLGEMLNQMAGIELQHVPYKGVAPALNDVLGGQLPLLFGSLPSTLAH
FT                   IKAGRLRALAVSSPQRSPVLPDVPALAEFVPGYSGTLWIGLFAPAGVPNEALARLQDGM
FT                   RQAMADKELRDKLEAQGVELAGTANKPVTPNEFAALLKQDIAKWAQIVKTSGATIN"
FT                   /protein_id="YP_004124872.1"
     MRRADFAIIT RRALCAGAVL GWALTAAPGA CAQGAYPSRP IVMVVPQAAG GTNDIVGRVV        60
     AQKLAEKLGG SAVVENKPGA GGNIGTQAVA RAPKDGYTLL MTISSSQAIN PALYKAPGFD       120
     PVADFQPISL IGAVPNVLLA HPSFPAKTVP ELLALAKSQP RTLQYASAGN GTLNHLLGEM       180
     LNQMAGIELQ HVPYKGVAPA LNDVLGGQLP LLFGSLPSTL AHIKAGRLRA LAVSSPQRSP       240
     VLPDVPALAE FVPGYSGTLW IGLFAPAGVP NEALARLQDG MRQAMADKEL RDKLEAQGVE       300
     LAGTANKPVT PNEFAALLKQ DIAKWAQIVK TSGATIN                                337
//

If you have problems or comments...

PBIL Back to PBIL home page