(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE199

ALDEN1_2.PE199       Location/Qualifiers
FT   CDS             complement(222438..223730)
FT                   /locus_tag="Alide_0201"
FT                   /gene_family="HOG000243801" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /codon_start="1"
FT                   /product="glu/leu/phe/val dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   dia:Dtpsy_0153 Glu/Leu/Phe/Val dehydrogenase"
FT                   /db_xref="GI:319760937"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="GeneID:10102224"
FT                   /translation="MTSPSGTHPLPSYLDPNHLGPWGVYLQQVDRVTPYLGNLARWVET
FT                   LKRPKRALIVDVPIELDNGTIAHFEGYRVQHNVSRGPGKGGVRFHQDVTLSEVMALSAW
FT                   MSIKNAAVNVPYGGAKGGIRVDPKTLSRGELERLTRRYTSEIGIIIGPSKDIPAPDVNT
FT                   NAQVMAWMMDTYSMNVGTTATGVVTGKPVDLGGSLGRVEATGRGVFTVGVEAARLTGMP
FT                   IEGARVAVQGFGNVGGTAGRLFSEAGAKVVAVQDHTGTIHNDKGLDVPALLAHVQQTGG
FT                   VAGFAGAEPMADDAFWGVACDILIPAALESQITKDNAGRIQARMVIEGANGPTTPEADD
FT                   ILHDKGVLVLPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINARLVRIMKEAFAGVWNV
FT                   AQENKVSLRTATFIVACKRILHAREMRGLYP"
FT                   /protein_id="YP_004124874.1"
     MTSPSGTHPL PSYLDPNHLG PWGVYLQQVD RVTPYLGNLA RWVETLKRPK RALIVDVPIE        60
     LDNGTIAHFE GYRVQHNVSR GPGKGGVRFH QDVTLSEVMA LSAWMSIKNA AVNVPYGGAK       120
     GGIRVDPKTL SRGELERLTR RYTSEIGIII GPSKDIPAPD VNTNAQVMAW MMDTYSMNVG       180
     TTATGVVTGK PVDLGGSLGR VEATGRGVFT VGVEAARLTG MPIEGARVAV QGFGNVGGTA       240
     GRLFSEAGAK VVAVQDHTGT IHNDKGLDVP ALLAHVQQTG GVAGFAGAEP MADDAFWGVA       300
     CDILIPAALE SQITKDNAGR IQARMVIEGA NGPTTPEADD ILHDKGVLVL PDVIANAGGV       360
     TVSYFEWVQD FSSFFWTEDE INARLVRIMK EAFAGVWNVA QENKVSLRTA TFIVACKRIL       420
     HAREMRGLYP                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page