(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE2

ALDEN1_2.PE2         Location/Qualifiers
FT   CDS             1754..2860
FT                   /locus_tag="Alide_0002"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: dia:Dtpsy_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:319760740"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:10102025"
FT                   /translation="MIVLKATQDKVLAVLQSVSGIVERRHTLPILANVLIRKTGNALQF
FT                   TTSDLEIQIRTTAELGGDTGDFTTTVGARKLIDILKTMPADQTVSLENSQTKLILKGGK
FT                   SRFTLQTLPAEDFPLVQEAASFGPAFSVPQKTLKTLLSQVSFAMAVQDIRYYLNGILFV
FT                   AEGKTLSLVATDGHRLAFASSELDMEVPKQEVILPRKTVLELQRLLSDADGAIEMRFAN
FT                   NQAKFGFGGMEFVTKLVEGKFPDYNRVIPRNHHNVITLGRAPLLASLQRTAIMTSEKFK
FT                   GVRLNIEPGSLRVASSNAEQEEAVDELDIDYGGDSIEIGFNVTYLIDVLANMGQDMVRM
FT                   ELADGNSSVVFGIPDNTHFKYVVMPMRI"
FT                   /product="DNA polymerase iii, beta subunit"
FT                   /protein_id="YP_004124677.1"
     MIVLKATQDK VLAVLQSVSG IVERRHTLPI LANVLIRKTG NALQFTTSDL EIQIRTTAEL        60
     GGDTGDFTTT VGARKLIDIL KTMPADQTVS LENSQTKLIL KGGKSRFTLQ TLPAEDFPLV       120
     QEAASFGPAF SVPQKTLKTL LSQVSFAMAV QDIRYYLNGI LFVAEGKTLS LVATDGHRLA       180
     FASSELDMEV PKQEVILPRK TVLELQRLLS DADGAIEMRF ANNQAKFGFG GMEFVTKLVE       240
     GKFPDYNRVI PRNHHNVITL GRAPLLASLQ RTAIMTSEKF KGVRLNIEPG SLRVASSNAE       300
     QEEAVDELDI DYGGDSIEIG FNVTYLIDVL ANMGQDMVRM ELADGNSSVV FGIPDNTHFK       360
     YVVMPMRI                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page