(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE200

ALDEN1_2.PE200       Location/Qualifiers
FT   CDS             223917..224366
FT                   /locus_tag="Alide_0202"
FT                   /gene_family="HOG000218246" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /codon_start="1"
FT                   /product="transmembrane pair domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transmembrane pair domain-containing protein;
FT                   KEGG: dia:Dtpsy_0156 transmembrane pair domain protein"
FT                   /db_xref="GI:319760938"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="GeneID:10102225"
FT                   /translation="MNATRTARGLQGPWRRLVFVSLYELIAILASSLLFMAIGQGAGAS
FT                   GAMAVVASTLAIVWNVTFNHLFEKWEARQSVKGRSAMRRVVHAMGFEGGLALALIPLMA
FT                   WWFGVSLWEATLMEAGLLLFFLVYTYLFNWAFDRIFGLPASAQPA"
FT                   /protein_id="YP_004124875.1"
     MNATRTARGL QGPWRRLVFV SLYELIAILA SSLLFMAIGQ GAGASGAMAV VASTLAIVWN        60
     VTFNHLFEKW EARQSVKGRS AMRRVVHAMG FEGGLALALI PLMAWWFGVS LWEATLMEAG       120
     LLLFFLVYTY LFNWAFDRIF GLPASAQPA                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page