(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE206

ALDEN1_2.PE206       Location/Qualifiers
FT   CDS             complement(234957..235937)
FT                   /locus_tag="Alide_0210"
FT                   /gene_family="HOG000289480" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02775"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer protein trbg"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2903 conjugal transfer protein
FT                   TrbG/VirB9/CagX; TIGRFAM: P-type conjugative transfer
FT                   protein TrbG; PFAM: Conjugal transfer protein
FT                   TrbG/VirB9/CagX"
FT                   /db_xref="GI:319760944"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="GeneID:10102233"
FT                   /translation="MNDLFRKSVLPVILLALSACATQGKPPPSISLDEPVQAQPLPEPP
FT                   APVEVVAMPQVLPMPAQMKPVPDAKPAAEPADETVRVSRANAEARIAPTREGYVNAIQV
FT                   WPFTDGALYQVYAAVGRVTVIALQPGEELVTVAAGDTVRWIVGDTSSGSGDALRVNVMV
FT                   KPIRSGLKTNLVITTSRRTYLIELTSTEKTWMASVSWEYPKDKMLALQRQAQAASAAAP
FT                   VDSGLSLEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVIGAQGD
FT                   GQLVNYRFRSPYYIVDRLFGAAELRLGGDKGDVVRIERTDGTRRN"
FT                   /protein_id="YP_004124881.1"
     MNDLFRKSVL PVILLALSAC ATQGKPPPSI SLDEPVQAQP LPEPPAPVEV VAMPQVLPMP        60
     AQMKPVPDAK PAAEPADETV RVSRANAEAR IAPTREGYVN AIQVWPFTDG ALYQVYAAVG       120
     RVTVIALQPG EELVTVAAGD TVRWIVGDTS SGSGDALRVN VMVKPIRSGL KTNLVITTSR       180
     RTYLIELTST EKTWMASVSW EYPKDKMLAL QRQAQAASAA APVDSGLSLE KIRFRYAVSG       240
     SNPPWKPLRA FDDGEKVYIQ FPPGIAQGEL PPLFVIGAQG DGQLVNYRFR SPYYIVDRLF       300
     GAAELRLGGD KGDVVRIERT DGTRRN                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page