(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE207

ALDEN1_2.PE207       Location/Qualifiers
FT   CDS             complement(235934..236638)
FT                   /locus_tag="Alide_0211"
FT                   /gene_family="HOG000289469" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Rpic_2651"
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein trbf"
FT                   /transl_table="11"
FT                   /note="KEGG: rpi:Rpic_2651 conjugal transfer protein TrbF"
FT                   /db_xref="GI:319760945"
FT                   /db_xref="GeneID:10102234"
FT                   /translation="MQFKRPQVRYADTPQPATPYQSAAQVWDERIGSTRVQAKNWRFMA
FT                   FGCLTLAVLMAGGLVWRSAQSIVTPYVIEVDNAGQVRAVGEAAAPYKPSDAQVAYHLGR
FT                   FIGLVRSLSIDPIVVRQNWLDAYDYTTDKGAVVLNEYARVNDPFARIGKESVTVQITSV
FT                   TRASDTSFNVRWTETRFVNGALDRTERWNAVVSIVQQTPRTEQRVRKNPLGIYVNGLSW
FT                   SRELEGNEGAKP"
FT                   /protein_id="YP_004124882.1"
     MQFKRPQVRY ADTPQPATPY QSAAQVWDER IGSTRVQAKN WRFMAFGCLT LAVLMAGGLV        60
     WRSAQSIVTP YVIEVDNAGQ VRAVGEAAAP YKPSDAQVAY HLGRFIGLVR SLSIDPIVVR       120
     QNWLDAYDYT TDKGAVVLNE YARVNDPFAR IGKESVTVQI TSVTRASDTS FNVRWTETRF       180
     VNGALDRTER WNAVVSIVQQ TPRTEQRVRK NPLGIYVNGL SWSRELEGNE GAKP             234
//

If you have problems or comments...

PBIL Back to PBIL home page