(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE208

ALDEN1_2.PE208       Location/Qualifiers
FT   CDS             complement(236657..237991)
FT                   /locus_tag="Alide_0212"
FT                   /gene_family="HOG000289458" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02783"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer protein trbl"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2905 conjugal transfer protein TrbL;
FT                   TIGRFAM: P-type conjugative transfer protein TrbL; PFAM:
FT                   TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /db_xref="GI:319760946"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="GeneID:10102235"
FT                   /translation="MNDVSVIDRFLDVFSRYIDSGFGLLHGEVAFLTATLIVIDMTLAG
FT                   LFWAMGHASGQGEDVISKLLRKVLYVGAFAYIIGNFNMLASAVFRSFAGLGLTASGSTL
FT                   SLGNFLQPGRLAKVGIDAGAPILEQIKEMAGFPEVFIHIMPIVVLFFAWMVVIVSFFVL
FT                   AVQLFVTLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVSSGIKVLVLAVIVGIGS
FT                   GLFSEFNIPAGSEPSIDRALVIMLASLAMLALGIFGPGIATGLVSGGPQLGAGAMAGAA
FT                   IGAAGTAVAVGAAAAGVGSAVTAGARMAPAAARSMTSTASIARSAYQAGSASAGGGLKG
FT                   AAAGVGNVAKTGARAAGQKVADGARSMKERMAAAFGPDDAQASSAASAGPDAAGSSPPV
FT                   EQPAWAKRLHRRQQLTHAATTAAHTLRGGDGGSSSQGPSLRDSDS"
FT                   /protein_id="YP_004124883.1"
     MNDVSVIDRF LDVFSRYIDS GFGLLHGEVA FLTATLIVID MTLAGLFWAM GHASGQGEDV        60
     ISKLLRKVLY VGAFAYIIGN FNMLASAVFR SFAGLGLTAS GSTLSLGNFL QPGRLAKVGI       120
     DAGAPILEQI KEMAGFPEVF IHIMPIVVLF FAWMVVIVSF FVLAVQLFVT LIEFKLTTLA       180
     GFVLVPFALW NKTAFLAEKV LGNVVSSGIK VLVLAVIVGI GSGLFSEFNI PAGSEPSIDR       240
     ALVIMLASLA MLALGIFGPG IATGLVSGGP QLGAGAMAGA AIGAAGTAVA VGAAAAGVGS       300
     AVTAGARMAP AAARSMTSTA SIARSAYQAG SASAGGGLKG AAAGVGNVAK TGARAAGQKV       360
     ADGARSMKER MAAAFGPDDA QASSAASAGP DAAGSSPPVE QPAWAKRLHR RQQLTHAATT       420
     AAHTLRGGDG GSSSQGPSLR DSDS                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page