(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE209

ALDEN1_2.PE209       Location/Qualifiers
FT   CDS             complement(238004..238729)
FT                   /locus_tag="Alide_0213"
FT                   /gene_family="HOG000289447" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02780"
FT                   /codon_start="1"
FT                   /product="p-type conjugative transfer protein trbj"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbJ;
FT                   KEGG: ajs:Ajs_2907 conjugal transfer protein TrbJ"
FT                   /db_xref="GI:319760947"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="GeneID:10102236"
FT                   /translation="MKRRLLAAAVAAMLCTATAHAQWVVIDPTNLIQNTLTAIQTLEQI
FT                   YNQIKQLENEAQMLRNQARNLASLPSSVVGQLRANLATTQRLIAQARGLAYDVTNLDRE
FT                   FQRLYPEQYAATVSGNQMYRDAQERWKNTLNGLQTTMQMQAQASQNLSDDESVLADLVG
FT                   KSQSAVGALQAMQATNQLLALQAKQSIQTQRLNITQDRAASLELARQAAAVERGREVNR
FT                   RFLGGGTPYTPQTVDFYSR"
FT                   /protein_id="YP_004124884.1"
     MKRRLLAAAV AAMLCTATAH AQWVVIDPTN LIQNTLTAIQ TLEQIYNQIK QLENEAQMLR        60
     NQARNLASLP SSVVGQLRAN LATTQRLIAQ ARGLAYDVTN LDREFQRLYP EQYAATVSGN       120
     QMYRDAQERW KNTLNGLQTT MQMQAQASQN LSDDESVLAD LVGKSQSAVG ALQAMQATNQ       180
     LLALQAKQSI QTQRLNITQD RAASLELARQ AAAVERGREV NRRFLGGGTP YTPQTVDFYS       240
     R                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page