(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE21

ALDEN1_2.PE21        Location/Qualifiers
FT   CDS             complement(28163..28966)
FT                   /locus_tag="Alide_0021"
FT                   /gene_family="HOG000256786" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0022 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319760759"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102044"
FT                   /translation="MARTRQIDFDEGADSRRFVTALARGLDVLACFHADEKWLANAEIA
FT                   ARTGLPKPTVVRLAYTLCVLGYLRHSRESGKYALGDSLAALGITMVSNLKLRRIARPYM
FT                   QDLADRYDISVSLGIRNGLSVLYVENCRSGAPLSLGLDLGSRIPVAETAMGHALLAVME
FT                   PRERERLLAEVRQAEPARWPRLREAIEAGCAHWQARGFTVVVRDWQTDIAGVGAAIRQP
FT                   DGRVITFNAGGSASKFPRELLEQEIGPQLARMVKGLESFVRSDDA"
FT                   /protein_id="YP_004124696.1"
     MARTRQIDFD EGADSRRFVT ALARGLDVLA CFHADEKWLA NAEIAARTGL PKPTVVRLAY        60
     TLCVLGYLRH SRESGKYALG DSLAALGITM VSNLKLRRIA RPYMQDLADR YDISVSLGIR       120
     NGLSVLYVEN CRSGAPLSLG LDLGSRIPVA ETAMGHALLA VMEPRERERL LAEVRQAEPA       180
     RWPRLREAIE AGCAHWQARG FTVVVRDWQT DIAGVGAAIR QPDGRVITFN AGGSASKFPR       240
     ELLEQEIGPQ LARMVKGLES FVRSDDA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page