(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE211

ALDEN1_2.PE211       Location/Qualifiers
FT   CDS             complement(241171..241443)
FT                   /locus_tag="Alide_0215"
FT                   /gene_family="HOG000289425" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2909"
FT                   /codon_start="1"
FT                   /product="conjugal transfer trbd transmembrane protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2909 conjugal transfer TrbD
FT                   transmembrane protein"
FT                   /db_xref="GI:319760949"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="GeneID:10102238"
FT                   /translation="MNGPHDGMPGFEVPLHRSLTEPILMGGAPRTVAITNGTLAAAVGL
FT                   GLQLWIPGVVLWIAGHSLAVWGARVDPQFMAVFARHIKHRPLLDV"
FT                   /protein_id="YP_004124886.1"
     MNGPHDGMPG FEVPLHRSLT EPILMGGAPR TVAITNGTLA AAVGLGLQLW IPGVVLWIAG        60
     HSLAVWGARV DPQFMAVFAR HIKHRPLLDV                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page