(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE212

ALDEN1_2.PE212       Location/Qualifiers
FT   CDS             complement(241440..241817)
FT                   /locus_tag="Alide_0216"
FT                   /gene_family="HOG000289414" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04956"
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein trbc"
FT                   /transl_table="11"
FT                   /note="PFAM: Conjugal transfer protein TrbC; KEGG:
FT                   dac:Daci_2698 conjugal transfer protein TrbC"
FT                   /db_xref="GI:319760950"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="GeneID:10102239"
FT                   /translation="MTHVDAFRISANPLPRPARLHGLARPAIQGLMLAAFMLLLAGTAQ
FT                   AAGSSMPWEGPLQSILESIQGPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLS
FT                   IAFAASSFFLSFFSFSGGAVV"
FT                   /protein_id="YP_004124887.1"
     MTHVDAFRIS ANPLPRPARL HGLARPAIQG LMLAAFMLLL AGTAQAAGSS MPWEGPLQSI        60
     LESIQGPVAR IVAVIIIIAT GLALAFGDTS GGFRKLIQIV FGLSIAFAAS SFFLSFFSFS       120
     GGAVV                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page