(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE214

ALDEN1_2.PE214       Location/Qualifiers
FT   CDS             complement(242845..243291)
FT                   /locus_tag="Alide_0218"
FT                   /gene_family="HOG000289403" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2912"
FT                   /codon_start="1"
FT                   /product="copg/DNA-binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2912 CopG/DNA-binding
FT                   domain-containing protein"
FT                   /db_xref="GI:319760952"
FT                   /db_xref="GeneID:10102241"
FT                   /translation="MTQHRLNVFIQPEHGKRLDELAAKKGVSKSSIVAAALASWLSPDA
FT                   ADQREAAIAKRLDRLSRHAERMERDLNIQIETLALFIRYFLTVSTPVPEAHQDAARAQG
FT                   KARFEQFVEQLGRHLLRGRSLVRDVVEELHPDPARMDDAQERAS"
FT                   /protein_id="YP_004124889.1"
     MTQHRLNVFI QPEHGKRLDE LAAKKGVSKS SIVAAALASW LSPDAADQRE AAIAKRLDRL        60
     SRHAERMERD LNIQIETLAL FIRYFLTVST PVPEAHQDAA RAQGKARFEQ FVEQLGRHLL       120
     RGRSLVRDVV EELHPDPARM DDAQERAS                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page