(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE216

ALDEN1_2.PE216       Location/Qualifiers
FT   CDS             complement(245507..245779)
FT                   /locus_tag="Alide_0220"
FT                   /gene_family="HOG000289371" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BMULJ_00894"
FT                   /codon_start="1"
FT                   /product="lipoprotein"
FT                   /transl_table="11"
FT                   /note="KEGG: bmj:BMULJ_00894 probable lipoprotein"
FT                   /db_xref="GI:319760954"
FT                   /db_xref="GeneID:10102243"
FT                   /translation="MNLSKIIAMSSLAVLLVACGKSEPSKPAAVPSVEELAADPVRLRE
FT                   LRQQCKTDRPTMGDVLCNRVAEATNRRFLGDGKVPYTPPKEPPKF"
FT                   /protein_id="YP_004124891.1"
     MNLSKIIAMS SLAVLLVACG KSEPSKPAAV PSVEELAADP VRLRELRQQC KTDRPTMGDV        60
     LCNRVAEATN RRFLGDGKVP YTPPKEPPKF                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page