(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE217

ALDEN1_2.PE217       Location/Qualifiers
FT   CDS             complement(245815..246708)
FT                   /locus_tag="Alide_0221"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: sml:Smlt1302 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760955"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102244"
FT                   /translation="MELRHLRYFLAVAEELHFARAAERLHIEQSPLSRAIRELEEELGA
FT                   QLFVRTSRSTRLTLAGKLLMENAPRVLLALDQARESVKAAANGFHGRLRVALSDGITPS
FT                   RLPALLARCREEDPEIEIRLFEVPLAQQLSGLRDDLYDAGFSMADEVGDGIIIEPAWED
FT                   ELMVAMPARHELLAHRRVPLDEVLQHPLVLGDPAVCEGHAKQIDRILRKQDREPLIEQY
FT                   VATFDVMMTFVSAGLALGLAGAAHIASSREPGVVGRPLAGKSPMLTTYLLRRDAEPSQA
FT                   LARFIERVEALGPGDA"
FT                   /protein_id="YP_004124892.1"
     MELRHLRYFL AVAEELHFAR AAERLHIEQS PLSRAIRELE EELGAQLFVR TSRSTRLTLA        60
     GKLLMENAPR VLLALDQARE SVKAAANGFH GRLRVALSDG ITPSRLPALL ARCREEDPEI       120
     EIRLFEVPLA QQLSGLRDDL YDAGFSMADE VGDGIIIEPA WEDELMVAMP ARHELLAHRR       180
     VPLDEVLQHP LVLGDPAVCE GHAKQIDRIL RKQDREPLIE QYVATFDVMM TFVSAGLALG       240
     LAGAAHIASS REPGVVGRPL AGKSPMLTTY LLRRDAEPSQ ALARFIERVE ALGPGDA          297
//

If you have problems or comments...

PBIL Back to PBIL home page