(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE218

ALDEN1_2.PE218       Location/Qualifiers
FT   CDS             complement(246778..249966)
FT                   /locus_tag="Alide_0222"
FT                   /gene_family="HOG000126203" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /codon_start="1"
FT                   /product="heavy metal efflux pump, czca family"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_1849 CzcA family heavy metal efflux
FT                   protein; TIGRFAM: heavy metal efflux pump, CzcA family;
FT                   PFAM: acriflavin resistance protein"
FT                   /db_xref="GI:319760956"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="GeneID:10102245"
FT                   /translation="MFEKLIRAAIEHRWLVLLAAIGMAAVGVFSYQKLPIDAVPDITNV
FT                   QVQINTQAPGYSPLETEQRVTYPIETVMAGLPNLEQTRSLSRYGLSQVTVIFKDGTDIY
FT                   FARQLVNERIQEARDKLPVGITPALGPISTGLGEIYLWTVEAKDGAKKPDGMPYTATDL
FT                   REIQDWIIKPQLRNVPGVTEINSIGGYAKEYQIAPIPARLASLGVTLQDIVTALDRNNG
FT                   NVGAGYIEKRGEQYLIRAPGQVKTLEDIGNVILSSAGGVPIRVRDVADVGLGRELRTGA
FT                   ATDNGREVVLGTVFMLIGQNSRTVSQAVDKKMVEINRSLPEGVHAVTVYDRTVLVDKAI
FT                   ATVKKNLLEGAILVIVILFLFLGNIRAAIITATVIPLSMLFTFTGMVHYKVSANLMSLG
FT                   ALDFGIIIDGAVVIVENCVRRLAHAQAHYGRPLTRTERFHEVFLASKESRRALLFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAFTVVAALVGAMILSVTFIPAAVALFIGHRVSETENF
FT                   LVVQAKRWYGPLLDRVMAAKAVVLAAAAVAVVLCGLIATRMGSEFVPSLNEGDFAIQAL
FT                   RIPGTSLSQSVAMQQRLEATLKAKFPEIDRVFARTGTAEIASDPMPPNISDGYIMLKPV
FT                   SEWPEPRKSRDELLAAIQEVVGKVPGNNYEFSQPIQLRFNELISGVRSDVAVKIFGDDM
FT                   DVLNKTGEEISSMLQKIPGASEVKVEQTTGLPMLTVNIDRQKASRYGLNVADIQDAVAT
FT                   AIGGREAGTLFEGDRRFDILVRLPESLRNDLESMKRLPIPLPRGTGGTGSAEGRTNFIQ
FT                   LAEVASFELAPGPNQVSRENGKRRIVVSANVRGRDVGSFVADAEAALAQVKIPTGYWTS
FT                   WGGTFENLQSATQRLQIVVPVSLLLVFLLLFAMFGNVKDGLLVFTGIPFALTGGILALW
FT                   LRDIPLSISAAVGFIALSGVAVLNGLVMISYIRSLREDGTPLDEAIREGALTRLRPVLM
FT                   TALVASLGFIPMAIATGTGAEVQRPLATVVIGGILSSTVLTLLVLPILYRLAHRPDEQE
FT                   EDVTAEPAHEGVTA"
FT                   /protein_id="YP_004124893.1"
     MFEKLIRAAI EHRWLVLLAA IGMAAVGVFS YQKLPIDAVP DITNVQVQIN TQAPGYSPLE        60
     TEQRVTYPIE TVMAGLPNLE QTRSLSRYGL SQVTVIFKDG TDIYFARQLV NERIQEARDK       120
     LPVGITPALG PISTGLGEIY LWTVEAKDGA KKPDGMPYTA TDLREIQDWI IKPQLRNVPG       180
     VTEINSIGGY AKEYQIAPIP ARLASLGVTL QDIVTALDRN NGNVGAGYIE KRGEQYLIRA       240
     PGQVKTLEDI GNVILSSAGG VPIRVRDVAD VGLGRELRTG AATDNGREVV LGTVFMLIGQ       300
     NSRTVSQAVD KKMVEINRSL PEGVHAVTVY DRTVLVDKAI ATVKKNLLEG AILVIVILFL       360
     FLGNIRAAII TATVIPLSML FTFTGMVHYK VSANLMSLGA LDFGIIIDGA VVIVENCVRR       420
     LAHAQAHYGR PLTRTERFHE VFLASKESRR ALLFGQLIIM VVYLPIFALT GVEGKMFHPM       480
     AFTVVAALVG AMILSVTFIP AAVALFIGHR VSETENFLVV QAKRWYGPLL DRVMAAKAVV       540
     LAAAAVAVVL CGLIATRMGS EFVPSLNEGD FAIQALRIPG TSLSQSVAMQ QRLEATLKAK       600
     FPEIDRVFAR TGTAEIASDP MPPNISDGYI MLKPVSEWPE PRKSRDELLA AIQEVVGKVP       660
     GNNYEFSQPI QLRFNELISG VRSDVAVKIF GDDMDVLNKT GEEISSMLQK IPGASEVKVE       720
     QTTGLPMLTV NIDRQKASRY GLNVADIQDA VATAIGGREA GTLFEGDRRF DILVRLPESL       780
     RNDLESMKRL PIPLPRGTGG TGSAEGRTNF IQLAEVASFE LAPGPNQVSR ENGKRRIVVS       840
     ANVRGRDVGS FVADAEAALA QVKIPTGYWT SWGGTFENLQ SATQRLQIVV PVSLLLVFLL       900
     LFAMFGNVKD GLLVFTGIPF ALTGGILALW LRDIPLSISA AVGFIALSGV AVLNGLVMIS       960
     YIRSLREDGT PLDEAIREGA LTRLRPVLMT ALVASLGFIP MAIATGTGAE VQRPLATVVI      1020
     GGILSSTVLT LLVLPILYRL AHRPDEQEED VTAEPAHEGV TA                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page