(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE219

ALDEN1_2.PE219       Location/Qualifiers
FT   CDS             complement(249983..251575)
FT                   /locus_tag="Alide_0223"
FT                   /gene_family="HOG000144730" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /codon_start="1"
FT                   /product="efflux transporter, rnd family, mfp subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_1848 RND family efflux transporter MFP
FT                   subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="GI:319760957"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="GeneID:10102246"
FT                   /translation="MKPETNKLNVGKKQWIAIVVIAAVGIGLGSAILGGKTGKSAEGEG
FT                   HGSHVEAKAHSDGEHHGKTGADSHEDDKGHADGEHHEGSSKGPHGGKLFKEGDFGLEAL
FT                   LAEDGGEPRLRIWLYEKEKALASSAAKVSATVTRLTGEKQALNFTPDKDSLLSREIVPE
FT                   PHAFEINIVAQTANAPFTFSFSQEEGKVELSDAQIKAASIGIDTAGAASIKSALQLPGE
FT                   IRLNEDRTSHVVPRIAGVVESVQASLGQTVKKGQVLAVIASPAASEQRSELQTAQKRLA
FT                   LAQTTFEREKRLWEQKISAEQDYLQAGQALNEAQVAVANAQQKLSAVGLAPGSSGGLNR
FT                   FELRAPFDGVVIEKHLSLGEAVKEDAAVFTVSDLGQVWAEINVPAKDLPLVRVGEKVSI
FT                   KATAFDASAQGTITFVGALIGEQTRMAKARVVLANPQGAWRPGLFVNVEVIASETAVPV
FT                   SVASDAIQSVGDKPVVFVKVKDGFVAQPVQLGRSDGKRVEVLQGLQAGAAYAAAGSFVV
FT                   KSELGKASAEHTH"
FT                   /protein_id="YP_004124894.1"
     MKPETNKLNV GKKQWIAIVV IAAVGIGLGS AILGGKTGKS AEGEGHGSHV EAKAHSDGEH        60
     HGKTGADSHE DDKGHADGEH HEGSSKGPHG GKLFKEGDFG LEALLAEDGG EPRLRIWLYE       120
     KEKALASSAA KVSATVTRLT GEKQALNFTP DKDSLLSREI VPEPHAFEIN IVAQTANAPF       180
     TFSFSQEEGK VELSDAQIKA ASIGIDTAGA ASIKSALQLP GEIRLNEDRT SHVVPRIAGV       240
     VESVQASLGQ TVKKGQVLAV IASPAASEQR SELQTAQKRL ALAQTTFERE KRLWEQKISA       300
     EQDYLQAGQA LNEAQVAVAN AQQKLSAVGL APGSSGGLNR FELRAPFDGV VIEKHLSLGE       360
     AVKEDAAVFT VSDLGQVWAE INVPAKDLPL VRVGEKVSIK ATAFDASAQG TITFVGALIG       420
     EQTRMAKARV VLANPQGAWR PGLFVNVEVI ASETAVPVSV ASDAIQSVGD KPVVFVKVKD       480
     GFVAQPVQLG RSDGKRVEVL QGLQAGAAYA AAGSFVVKSE LGKASAEHTH                  530
//

If you have problems or comments...

PBIL Back to PBIL home page