(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE22

ALDEN1_2.PE22        Location/Qualifiers
FT   CDS             29153..30124
FT                   /locus_tag="Alide_0022"
FT                   /gene_family="HOG000126605" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0005"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0005 hypothetical protein"
FT                   /db_xref="GI:319760760"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102045"
FT                   /translation="MTRPLFSRRTLALLLAAGFAAGPALAQADRFPNRPIKVLIGFTAG
FT                   GSTDVPFRVLAENASKILGQPVIIENKPGAGGVLPAQMMQNTPADGYTLAQIPLPVFRL
FT                   PYTQKINWDPATDLQYVIGLAGYAFGLVVPADSPIKSMQDYIAYAKTHPGKLNYGTPGA
FT                   LTTLHLTMENIAMQAGVTLNHIPFKGNSESLQAVLGGHVMSVADTPGWAPYVEQGKLRL
FT                   LSTWGDKRSAKFPNTPTLKESGINLVQTSPFGLAAPKGTDPKVVQVLHDAFKKAMEMPN
FT                   YKESLAKFDMDTYYMDSATYRQYALDTMKTEKVIIDKLGLGK"
FT                   /protein_id="YP_004124697.1"
     MTRPLFSRRT LALLLAAGFA AGPALAQADR FPNRPIKVLI GFTAGGSTDV PFRVLAENAS        60
     KILGQPVIIE NKPGAGGVLP AQMMQNTPAD GYTLAQIPLP VFRLPYTQKI NWDPATDLQY       120
     VIGLAGYAFG LVVPADSPIK SMQDYIAYAK THPGKLNYGT PGALTTLHLT MENIAMQAGV       180
     TLNHIPFKGN SESLQAVLGG HVMSVADTPG WAPYVEQGKL RLLSTWGDKR SAKFPNTPTL       240
     KESGINLVQT SPFGLAAPKG TDPKVVQVLH DAFKKAMEMP NYKESLAKFD MDTYYMDSAT       300
     YRQYALDTMK TEKVIIDKLG LGK                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page