(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE221

ALDEN1_2.PE221       Location/Qualifiers
FT   CDS             complement(253070..253423)
FT                   /locus_tag="Alide_0225"
FT                   /gene_family="HOG000229574" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daro_2621"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: dar:Daro_2621 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760959"
FT                   /db_xref="InterPro:IPR020487"
FT                   /db_xref="GeneID:10102248"
FT                   /translation="MRKWLAIVLLVFLPLQFSWAAVASYCQHETGAAAKHFGHHAHQHK
FT                   AADGKDASPDPAKTLGGDPDCASCHAGCFSVLSGDVKLASSISPSLDTAYHPESLAAPP
FT                   PERLERPRWRALA"
FT                   /protein_id="YP_004124896.1"
     MRKWLAIVLL VFLPLQFSWA AVASYCQHET GAAAKHFGHH AHQHKAADGK DASPDPAKTL        60
     GGDPDCASCH AGCFSVLSGD VKLASSISPS LDTAYHPESL AAPPPERLER PRWRALA          117
//

If you have problems or comments...

PBIL Back to PBIL home page