(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE222

ALDEN1_2.PE222       Location/Qualifiers
FT   CDS             complement(253630..253965)
FT                   /locus_tag="Alide_0226"
FT                   /gene_family="HOG000229681" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2700"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2700 hypothetical protein"
FT                   /db_xref="GI:319760960"
FT                   /db_xref="GeneID:10102249"
FT                   /translation="MKLTHLVAMKAIILATALPMAAQADSLWHPASNEQGFTYHPDHFK
FT                   STKTRAQVLAEVEAARKDGTLTLMQGGLPVPIKSSAAPKTRQQVVDEMRSESPEARRAR
FT                   LEMYSGG"
FT                   /protein_id="YP_004124897.1"
     MKLTHLVAMK AIILATALPM AAQADSLWHP ASNEQGFTYH PDHFKSTKTR AQVLAEVEAA        60
     RKDGTLTLMQ GGLPVPIKSS AAPKTRQQVV DEMRSESPEA RRARLEMYSG G                111
//

If you have problems or comments...

PBIL Back to PBIL home page