(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE224

ALDEN1_2.PE224       Location/Qualifiers
FT   CDS             254925..256115
FT                   /locus_tag="Alide_0228"
FT                   /gene_family="HOG000126763" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01386"
FT                   /codon_start="1"
FT                   /product="heavy metal sensor kinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; KEGG: dia:Dtpsy_2216 heavy metal sensor signal
FT                   transduction histidine kinase; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="GI:319760962"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0004673"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="GeneID:10102251"
FT                   /translation="MDTLRQQQTQVNHLIAEAAELDSGTLAHKLDDGMVGRQDMKLILT
FT                   RADGSVIYASAGIPVHHRVIDMRFEATTGIPPIQAVLSLDVSEDDRVLERLARTLVAAA
FT                   LAGAVVIAAGGFTLVQIGLRPVRDLSAQIQALEADTLHRLLDGSAQPDELAPLVAHVNE
FT                   LLKRLHKAYEQLEAFNADVAHELFTPLATLMGGTEVALRKARDADTLRDVLGSHLEDLQ
FT                   RMSMIVQDMLFLSQADRGAEARREHVASMAGVARTVVELHEAAIEEAGLKVRINGDATG
FT                   LADVRLLQRALSNLIGNATRHAHPHSTVVVQIDRLDGEIALRVVNEGQTISAEHLPNLF
FT                   NRFYRADAARSDAARNHGLGLAIVAAIARMHGGRTMVDSSNGITSIGLMVPTPRAQ"
FT                   /protein_id="YP_004124899.1"
     MDTLRQQQTQ VNHLIAEAAE LDSGTLAHKL DDGMVGRQDM KLILTRADGS VIYASAGIPV        60
     HHRVIDMRFE ATTGIPPIQA VLSLDVSEDD RVLERLARTL VAAALAGAVV IAAGGFTLVQ       120
     IGLRPVRDLS AQIQALEADT LHRLLDGSAQ PDELAPLVAH VNELLKRLHK AYEQLEAFNA       180
     DVAHELFTPL ATLMGGTEVA LRKARDADTL RDVLGSHLED LQRMSMIVQD MLFLSQADRG       240
     AEARREHVAS MAGVARTVVE LHEAAIEEAG LKVRINGDAT GLADVRLLQR ALSNLIGNAT       300
     RHAHPHSTVV VQIDRLDGEI ALRVVNEGQT ISAEHLPNLF NRFYRADAAR SDAARNHGLG       360
     LAIVAAIARM HGGRTMVDSS NGITSIGLMV PTPRAQ                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page