(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE226

ALDEN1_2.PE226       Location/Qualifiers
FT   CDS             complement(256847..257137)
FT                   /locus_tag="Alide_0230"
FT                   /gene_family="HOG000011608" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Sfri_3475"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: sfr:Sfri_3475 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760964"
FT                   /db_xref="GeneID:10102253"
FT                   /translation="MGILDRIFGGHGGGHGSSHGHGNSRGHGSPSSHDWGHNPAPSVSG
FT                   ITCPQCKAINPNGARFCGQCGTSLVPASCTKCSSVIPIGAKFCAQCGNAVT"
FT                   /protein_id="YP_004124901.1"
     MGILDRIFGG HGGGHGSSHG HGNSRGHGSP SSHDWGHNPA PSVSGITCPQ CKAINPNGAR        60
     FCGQCGTSLV PASCTKCSSV IPIGAKFCAQ CGNAVT                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page