(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE227

ALDEN1_2.PE227       Location/Qualifiers
FT   CDS             complement(257160..259469)
FT                   /locus_tag="Alide_0231"
FT                   /gene_family="HOG000250399" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /codon_start="1"
FT                   /product="heavy metal translocating p-type atpase"
FT                   /transl_table="11"
FT                   /note="KEGG: vap:Vapar_3562 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; cadmium-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="GI:319760965"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR001366"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006404"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="GeneID:10102254"
FT                   /translation="MDCASEESEIRRALEGMAGIRGLRFNLGDRELAIAADDHALPQAL
FT                   EAIRKAGFKPEPLGAKNAQRFRIANMDCASEESEIRRALDGMAGIRSLQFNLGDRELAI
FT                   AADDPVLQQAVDAIRKAGFKPEPLGDTGSSAAAAAVASPTGFWTTWGKSLGALGLAVAA
FT                   EGLAFAFPDSVPVKALGMALAAAAIALSGFSVYGKGLAALRQGRLNINALMTVAVTGAF
FT                   LIGQWPEAAMVMALYAIAEAIEARAVDRARGAIKSLLALAPEQAEVRQDDGSWARIGVK
FT                   EVTVGATVRIRPGERLPLDGIVTLGQSAIDQSPVTGESLPVDKSPGDEVFAGTINQAAA
FT                   LEIRVTAPASDSTLARIIHAVEQAQSSRAPTQRFVDRFAAIYTPAVFVLAVAVALLAPW
FT                   LMGLTWMQAAYKALVLLVIACPCALVISTPVTVVSGLAAGARRGILIKGGVYLEEARKI
FT                   KAVALDKTGTITEGKPKLVAFEPVDAGLGQQVLEGLAKSLAARSDHPVSKAIADGVSSA
FT                   AQEVDEFQAVAGRGVQGVIDGHTYVLANHRWIEERGQCSAELEARLAVHEQAGRTVTLL
FT                   ASSERVMAICAVADTIKPSSAQAVADLKALGVTPVMLTGDNLATAQTVGAQAGIAEVRG
FT                   NLLPEDKLRAIGELQQRLGVTAMTGDGINDAPALAKADIGFAMGGAGTHTAMEAADVVV
FT                   MNDDLRRLPETIRLSKRTHAVLWQNIALALGIKLVFLLLAIFDDASMWMAVFADMGASL
FT                   LVVFNGLRLLRQRAGQ"
FT                   /protein_id="YP_004124902.1"
     MDCASEESEI RRALEGMAGI RGLRFNLGDR ELAIAADDHA LPQALEAIRK AGFKPEPLGA        60
     KNAQRFRIAN MDCASEESEI RRALDGMAGI RSLQFNLGDR ELAIAADDPV LQQAVDAIRK       120
     AGFKPEPLGD TGSSAAAAAV ASPTGFWTTW GKSLGALGLA VAAEGLAFAF PDSVPVKALG       180
     MALAAAAIAL SGFSVYGKGL AALRQGRLNI NALMTVAVTG AFLIGQWPEA AMVMALYAIA       240
     EAIEARAVDR ARGAIKSLLA LAPEQAEVRQ DDGSWARIGV KEVTVGATVR IRPGERLPLD       300
     GIVTLGQSAI DQSPVTGESL PVDKSPGDEV FAGTINQAAA LEIRVTAPAS DSTLARIIHA       360
     VEQAQSSRAP TQRFVDRFAA IYTPAVFVLA VAVALLAPWL MGLTWMQAAY KALVLLVIAC       420
     PCALVISTPV TVVSGLAAGA RRGILIKGGV YLEEARKIKA VALDKTGTIT EGKPKLVAFE       480
     PVDAGLGQQV LEGLAKSLAA RSDHPVSKAI ADGVSSAAQE VDEFQAVAGR GVQGVIDGHT       540
     YVLANHRWIE ERGQCSAELE ARLAVHEQAG RTVTLLASSE RVMAICAVAD TIKPSSAQAV       600
     ADLKALGVTP VMLTGDNLAT AQTVGAQAGI AEVRGNLLPE DKLRAIGELQ QRLGVTAMTG       660
     DGINDAPALA KADIGFAMGG AGTHTAMEAA DVVVMNDDLR RLPETIRLSK RTHAVLWQNI       720
     ALALGIKLVF LLLAIFDDAS MWMAVFADMG ASLLVVFNGL RLLRQRAGQ                   769
//

If you have problems or comments...

PBIL Back to PBIL home page