(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE228

ALDEN1_2.PE228       Location/Qualifiers
FT   CDS             259708..260163
FT                   /locus_tag="Alide_0232"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02047"
FT                   /codon_start="1"
FT                   /product="cd(ii)/pb(ii)-responsive transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="SMART: regulatory protein MerR; manually curated;
FT                   TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; KEGG: mpt:Mpe_A1657 transcriptional regulator;
FT                   PFAM: Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR"
FT                   /db_xref="GI:319760966"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="GeneID:10102255"
FT                   /translation="MKIGELAKAAHTQVETIRYYEREGLLPETARTDGNYRMYAEEHVD
FT                   RLSFIRHCRGLDMTLDEIRVLLRFKDAPHENCAQVNDLLDEHIDHVATRIKELKALERQ
FT                   LKTLRESCRESQQASQCGILTELSSASRQVHEPATRRGHVHGAHSLK"
FT                   /protein_id="YP_004124903.1"
     MKIGELAKAA HTQVETIRYY EREGLLPETA RTDGNYRMYA EEHVDRLSFI RHCRGLDMTL        60
     DEIRVLLRFK DAPHENCAQV NDLLDEHIDH VATRIKELKA LERQLKTLRE SCRESQQASQ       120
     CGILTELSSA SRQVHEPATR RGHVHGAHSL K                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page