(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE230

ALDEN1_2.PE230       Location/Qualifiers
FT   CDS             complement(262143..262598)
FT                   /locus_tag="Alide_0234"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Smlt1309"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="manually curated; KEGG: sml:Smlt1309 hypothetical
FT                   protein"
FT                   /db_xref="GI:319760968"
FT                   /db_xref="GeneID:10102257"
FT                   /translation="MMAADSLHVAVHLVVPSGVSCCWPSPCRSACSASASAPHFALPSA
FT                   QPSNVQASCLERARSVAVFAFAGALAARAAAPPGRRCPERQRGAKAEGKTKGCGTCRPA
FT                   KPVCTWGWRGTERLRRRAAWGAKPAPMQACPRASHDRTRQSLQGAQP"
FT                   /protein_id="YP_004124905.1"
     MMAADSLHVA VHLVVPSGVS CCWPSPCRSA CSASASAPHF ALPSAQPSNV QASCLERARS        60
     VAVFAFAGAL AARAAAPPGR RCPERQRGAK AEGKTKGCGT CRPAKPVCTW GWRGTERLRR       120
     RAAWGAKPAP MQACPRASHD RTRQSLQGAQ P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page