(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE231

ALDEN1_2.PE231       Location/Qualifiers
FT   CDS             complement(262595..263194)
FT                   /locus_tag="Alide_0235"
FT                   /gene_family="HOG000289337" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10502"
FT                   /codon_start="1"
FT                   /product="peptidase s26, conserved region protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidase S26, conserved region; KEGG:
FT                   dia:Dtpsy_1292 TraF peptidase. Serine peptidase. MEROPS
FT                   family S26C"
FT                   /db_xref="GI:319760969"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="GeneID:10102258"
FT                   /translation="MTFPSAVAGAAGIPPRPRSRLRARIVLAGLSACGLAALAWASFVQ
FT                   PMPRLIYNPSDSVAVGWYRVDPLGHDTGSLPRPLSVGSIVLTTLPPDAAALAAQRGYLP
FT                   ARVPLLKRVGAVAPQEVCITGRVVRIDGVPSAAVLPADRWGRPLPSWQQCRHLEPGELF
FT                   LLSVTNPASFDSRYFGPVSTSAVIGVAHPVWLESRP"
FT                   /protein_id="YP_004124906.1"
     MTFPSAVAGA AGIPPRPRSR LRARIVLAGL SACGLAALAW ASFVQPMPRL IYNPSDSVAV        60
     GWYRVDPLGH DTGSLPRPLS VGSIVLTTLP PDAAALAAQR GYLPARVPLL KRVGAVAPQE       120
     VCITGRVVRI DGVPSAAVLP ADRWGRPLPS WQQCRHLEPG ELFLLSVTNP ASFDSRYFGP       180
     VSTSAVIGVA HPVWLESRP                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page