(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE232

ALDEN1_2.PE232       Location/Qualifiers
FT   CDS             complement(263191..263736)
FT                   /locus_tag="Alide_0236"
FT                   /gene_family="HOG000289326" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_3522"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3522 hypothetical protein"
FT                   /db_xref="GI:319760970"
FT                   /db_xref="GeneID:10102259"
FT                   /translation="MTASVSSAAAPVACAATAALAAPSGQPASAPLTRVALAYIEPRFK
FT                   LYLRFGEPARTLQLDRWRRCAVFLPGAMLCRIRWQANDYGTIRWQLMVMQACTPLDAAQ
FT                   RIPGVQPGARLLLHAEGENQVRAVLERIDAIEALGIAPNGASPAYWRTLANRLAARLPL
FT                   PEYTAERHAAWLTGRALS"
FT                   /protein_id="YP_004124907.1"
     MTASVSSAAA PVACAATAAL AAPSGQPASA PLTRVALAYI EPRFKLYLRF GEPARTLQLD        60
     RWRRCAVFLP GAMLCRIRWQ ANDYGTIRWQ LMVMQACTPL DAAQRIPGVQ PGARLLLHAE       120
     GENQVRAVLE RIDAIEALGI APNGASPAYW RTLANRLAAR LPLPEYTAER HAAWLTGRAL       180
     S                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page