(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE233

ALDEN1_2.PE233       Location/Qualifiers
FT   CDS             complement(263733..264017)
FT                   /locus_tag="Alide_0237"
FT                   /gene_family="HOG000289305" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_0688"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_0688 hypothetical protein"
FT                   /db_xref="GI:319760971"
FT                   /db_xref="GeneID:10102260"
FT                   /translation="MTAKPPPNGKRTAKRVSIGARPPANPHAEAWIRQGDADALGKGDL
FT                   YTARLTLDITPAMRARIKVSAFTQGVTVADLLRGLLEREFPEHRRENTP"
FT                   /protein_id="YP_004124908.1"
     MTAKPPPNGK RTAKRVSIGA RPPANPHAEA WIRQGDADAL GKGDLYTARL TLDITPAMRA        60
     RIKVSAFTQG VTVADLLRGL LEREFPEHRR ENTP                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page