(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE234

ALDEN1_2.PE234       Location/Qualifiers
FT   CDS             complement(264014..264652)
FT                   /locus_tag="Alide_0238"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1879"
FT                   /codon_start="1"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: tgr:Tgr7_1879 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="GI:319760972"
FT                   /db_xref="GeneID:10102261"
FT                   /translation="MIVALLNQKGGVGKTTLATHIAGELAMRGQHVVLLDADPQGSSLD
FT                   WTQRRSQQGLPRLFSAVGLARETLHQEAPELARRADHVVIDGPPRIAALARSALLAAER
FT                   VLIPVQPSPYDLWASAEMVALIREAQVFRPALRAAFVINRRVSTTVIGREARQALADQP
FT                   LPALRAEVHQRIVFADSVAAGRLARETAPDSAAAREITALVDELLRWTP"
FT                   /protein_id="YP_004124909.1"
     MIVALLNQKG GVGKTTLATH IAGELAMRGQ HVVLLDADPQ GSSLDWTQRR SQQGLPRLFS        60
     AVGLARETLH QEAPELARRA DHVVIDGPPR IAALARSALL AAERVLIPVQ PSPYDLWASA       120
     EMVALIREAQ VFRPALRAAF VINRRVSTTV IGREARQALA DQPLPALRAE VHQRIVFADS       180
     VAAGRLARET APDSAAAREI TALVDELLRW TP                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page