(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE236

ALDEN1_2.PE236       Location/Qualifiers
FT   CDS             complement(265766..266047)
FT                   /locus_tag="Alide_0240"
FT                   /gene_family="HOG000289292" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2652"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2652 hypothetical protein"
FT                   /db_xref="GI:319760974"
FT                   /db_xref="GeneID:10102263"
FT                   /translation="MRPAPLRPAATVSTAAAQPQRYLTNDEAAEYLRLSPRTLEKQRVI
FT                   GGGPRFRKFGRRVMYAVADLDAWAADRSFETTSDPEYAEHHSADSRAR"
FT                   /protein_id="YP_004124911.1"
     MRPAPLRPAA TVSTAAAQPQ RYLTNDEAAE YLRLSPRTLE KQRVIGGGPR FRKFGRRVMY        60
     AVADLDAWAA DRSFETTSDP EYAEHHSADS RAR                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page