(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE237

ALDEN1_2.PE237       Location/Qualifiers
FT   CDS             complement(266131..266904)
FT                   /locus_tag="Alide_0241"
FT                   /gene_family="HOG000289271" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_2651"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_2651 hypothetical protein"
FT                   /db_xref="GI:319760975"
FT                   /db_xref="GeneID:10102264"
FT                   /translation="MVSPHHFAHWYPTAAYLYVLWLDTLALAWEYLRRHPDYRLDWLRR
FT                   ARRPDAAHRWGLRLLEDPALDARDAHPAWQPGHAAVVQLHPDADPPVDAESFAFWRIPG
FT                   HKQLLHDGKRLALIAHSPGHCLRFALAPGLEDGMAVAYAVRTDATASPRYRACGTTLAT
FT                   PAAVALPRPAPVALLELHTLQALDATLAGASLREVGEGLFGVDAVADWYADGGLRSKVR
FT                   RLVRRGDALMRGGYRRLAQLPPLEKGRFDADAKRP"
FT                   /protein_id="YP_004124912.1"
     MVSPHHFAHW YPTAAYLYVL WLDTLALAWE YLRRHPDYRL DWLRRARRPD AAHRWGLRLL        60
     EDPALDARDA HPAWQPGHAA VVQLHPDADP PVDAESFAFW RIPGHKQLLH DGKRLALIAH       120
     SPGHCLRFAL APGLEDGMAV AYAVRTDATA SPRYRACGTT LATPAAVALP RPAPVALLEL       180
     HTLQALDATL AGASLREVGE GLFGVDAVAD WYADGGLRSK VRRLVRRGDA LMRGGYRRLA       240
     QLPPLEKGRF DADAKRP                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page