(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE238

ALDEN1_2.PE238       Location/Qualifiers
FT   CDS             complement(267233..267583)
FT                   /locus_tag="Alide_0242"
FT                   /gene_family="HOG000289270" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_3529"
FT                   /codon_start="1"
FT                   /product="lipoprotein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_3529 lipoprotein"
FT                   /db_xref="GI:319760976"
FT                   /db_xref="GeneID:10102265"
FT                   /translation="MNAPLVTDAQRAALLANGRRVAAAEPHDPLPVVRLFTPDAHAIWL
FT                   LASLDPADGDTAFGVMDVGIGMPELGHIKLSDLTSIVGPNKQPVMRDLYFQAVHPLSEY
FT                   LRLAQENGSIVD"
FT                   /protein_id="YP_004124913.1"
     MNAPLVTDAQ RAALLANGRR VAAAEPHDPL PVVRLFTPDA HAIWLLASLD PADGDTAFGV        60
     MDVGIGMPEL GHIKLSDLTS IVGPNKQPVM RDLYFQAVHP LSEYLRLAQE NGSIVD           116
//

If you have problems or comments...

PBIL Back to PBIL home page